Qiagen
Home  >  Products  >  Anti-FOXL1 (full length) polyclonal antibody

Anti-FOXL1 (full length) polyclonal antibody

Cat no: DPABH-09404


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09404
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 2300
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human FOXL1 aa 1-345.Sequence: MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKP PYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHN LSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPG APEAKRPRAETHQRSAEAQPEA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2300
Alternative names: FOXL1; forkhead box L1; FKHL11; forkhead box protein L1; FKH6; FREAC7; FREAC-7; forkhead-like 11; forkhead-related protein FKHL11; forkhead-related transcription factor 7;
Additional info: FOXL1 (forkhead box L1) is a protein-coding gene. Diseases associated with FOXL1 include lymphedema-distichiasis syndrome, and hereditary lymphedema. GO annotations related to this gene include transcription factor binding and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is FOXF1.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave