Qiagen
Home  >  Products  >  Anti-FMNL1 (full length) polyclonal antibody

Anti-FMNL1 (full length) polyclonal antibody

Cat no: DPABH-09322


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09322
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 752
Form: Liquid
Antigen: Full length protein corresponding to Human FMNL1 aa 1-463.Sequence: MPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSLD LSALKSKAAQKAPSKATLIEANRAKNLAITLRKGNLGAERICQAIEAYDL QALGLDFLELLMRFLPTEYERSLITRFEREQRPMEELSEEDRFMLCFSRI PRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAAS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 752
Alternative names: FMNL1; formin-like 1; C17orf1B, FMNL, formin like; formin-like protein 1; C17orf1; leukocyte formin; CLL-associated antigen KW-13; FMNL; FHOD4; KW-13; C17orf1B; MGC1894; MGC21878; MGC133052;
Additional info: May play a role in the control of cell motility and survival of macrophages (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave