Qiagen
Home  >  Products  >  Anti-FGL1 (full length) polyclonal antibody

Anti-FGL1 (full length) polyclonal antibody

Cat no: DPABH-09418


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09418
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 2267
Form: Liquid
Antigen: Full length protein corresponding to Human FGL1 aa 1-312.Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVK IKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIK PLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQK HGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRY
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2267
Alternative names: FGL1; fibrinogen-like 1; fibrinogen-like protein 1; HFREP 1; hepassocin; liver fibrinogen-related protein 1; hepatocellular carcinoma-related sequence; hepatocyte-derived fibrinogen-related protein 1; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455;
Additional info: Has hepatocyte mitogenic activity.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave