Qiagen
Home  >  Products  >  Anti-FANCG (full length) polyclonal antibody

Anti-FANCG (full length) polyclonal antibody

Cat no: DPABH-09366


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09366
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 2189
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human FANCG aa 1-622.Sequence: MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGL RGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSL ERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALW LSADRLGDLALLLETLNGSQSGASKDLLLLLKTW
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2189
Alternative names: FANCG; Fanconi anemia, complementation group G; XRCC9; Fanconi anemia group G protein; DNA repair protein XRCC9; FAG; X ray repair complementing defective repair in Chinese hamster cells 9; X ray repair; complementing defective; in Chinese hamster; 9; X-ray repair, complementing defective, in Chinese hamster, 9; X-ray repair complementing defective repair in Chinese hamster cells 9;
Additional info: DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. Candidate tumor suppressor gene.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave