Qiagen
Home  >  Products  >  Anti-EXTL2 (aa 39-330) polyclonal antibody

Anti-EXTL2 (aa 39-330) polyclonal antibody

Cat no: DPABH-09354


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09354
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 2135
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant fragment corresponding to Human EXTL2 aa 39-330. Swissprot: Q9UBQ6Sequence: LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQA VPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVF PELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSG IYSYGSFEMQAPGS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped on Dry Ice. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2135
Alternative names: EXTL2; exostoses (multiple)-like 2; exostosin-like 2; alpha 1; 4 N acteylhexosaminyltransferase; alpha-GalNAcT EXTL2; EXT-related protein 2; processed exostosin-like 2; alpha-1,4-N-acteylhexosaminyltransferase; alpha-1,4-N-acetylhexosaminyltransferase EXTL2; glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXTR2;
Additional info: Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave