Qiagen
Home  >  Products  >  Anti-EPB42 (full length) polyclonal antibody

Anti-EPB42 (full length) polyclonal antibody

Cat no: DPABH-09352


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09352
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 2038
Form: Liquid
Antigen: Recombinant full length protein corresponding to Human EPB42 aa 1-619.Sequence: MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVR AFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQ SWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLK NEAQRMEYLLNQNGLIYLGTAD
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped on Dry Ice. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 2038
Alternative names: EPB42; erythrocyte membrane protein band 4.2; Erythrocyte surface protein band 4.2; MGC116735; MGC116737; PA; P4.2; erythrocyte protein 4.2; erythrocyte surface protein band 4.2; SPH5;
Additional info: Probably plays an important role in the regulation of erythrocyte shape and mechanical properties.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave