Qiagen
Home  >  Products  >  Anti-EDC4 (full length) polyclonal antibody

Anti-EDC4 (full length) polyclonal antibody

Cat no: DPABH-09870


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09870
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 23644
Form: Liquid
Antigen: Full length protein corresponding to Human EDC4 aa 1-1401. (NP_055144.3)Sequence: MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVP DPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEI VASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIR AANNGSAMVRVISVSTSERT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23644
Alternative names: EDC4; enhancer of mRNA decapping 4; enhancer of mRNA-decapping protein 4; Ge 1; HEDLS; RCD 8; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit; Ge-1; RCD-8;
Additional info: In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave