Qiagen
Home  >  Products  >  Anti-DNAJB2 (full length) polyclonal antibody

Anti-DNAJB2 (full length) polyclonal antibody

Cat no: DPABH-09444


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09444
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 3300
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human DNAJB2 aa 1-277. (NP_001034639).Sequence: MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVA EAYEVLSDKHKREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPE EVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTFSSSFPGHSDF SSSSFSFSPGAGAFRSV
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3300
Alternative names: DNAJB2; DnaJ (Hsp40) homolog, subfamily B, member 2; HSJ1; dnaJ homolog subfamily B member 2; HSPF3; heat shock protein J1; dnaJ protein homolog 1; heat shock 40 kDa protein 3; heat shock protein, neuronal DNAJ-like 1; HSJ-1;
Additional info: DNAJB2 is involved in heat shock protein and unfolded protein binding.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave