Qiagen
Home  >  Products  >  Anti-DIP2A (full length) polyclonal antibody

Anti-DIP2A (full length) polyclonal antibody

Cat no: DPABH-09816


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09816
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 23181
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human DIP2A aa 1-889.Sequence: MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYI PLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEA VQAALAKYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPG RLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23181
Alternative names: DIP2A; DIP2 disco-interacting protein 2 homolog A (Drosophila); C21orf106, chromosome 21 open reading frame 106; disco-interacting protein 2 homolog A; Dip2; KIAA0184; DIP2 homolog A; disco-interacting protein 2A; DIP2; C21orf106;
Additional info: May provide positional cues for axon pathfinding and patterning in the central nervous system.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave