Qiagen
Home  >  Products  >  Anti-CYP7B1 (full length) polyclonal antibody

Anti-CYP7B1 (full length) polyclonal antibody

Cat no: DPABH-09766


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09766
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9420
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human CYP7B1 aa 1-506. (NCBI: NP_004811.1)Sequence: MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIK GWLPYLGVVLNLRKDPLRFMKTLQKQHGDTFTVLLGGKYITFILDPFQYQ LVIKNHKQLSFRVFSNKLLEKAFSISQLQKNHDMNDELHLCYQFLQGKSL DILLESMMQNLKQ
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C. Avoid freeze / thaw cycle.
Entrez gene: 9420
Alternative names: CYP7B1; cytochrome P450, family 7, subfamily B, polypeptide 1; cytochrome P450, subfamily VIIB (oxysterol 7 alpha hydroxylase), polypeptide 1; spastic paraplegia 5A (autosomal recessive); SPG5A; 25-hydroxycholesterol 7-alpha-hydroxylase; cytochrome P450 7B1; oxysterol 7alpha-hydroxylase; oxysterol 7-alpha-hydroxylase; cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1; CP7B; CBAS3; SPG5A;
Additional info: CYP7B1 (cytochrome P450, family 7, subfamily B, polypeptide 1) is a protein-coding gene. Diseases associated with CYP7B1 include bile acid synthesis defect, congenital, 3, and spastic paraplegia 5a, and among its related super-pathways are Synthesis of bile acids and bile salts and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include electron carrier activity and heme binding. An important paralog of this gene is CYP39A1.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave