Qiagen
Home  >  Products  >  Anti-CRLF1 (full length) polyclonal antibody

Anti-CRLF1 (full length) polyclonal antibody

Cat no: DPABH-09788


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09788
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9244
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human CRLF1 aa 1-422. (NP_004741.1)Sequence: MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTL LIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALAL ANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKD LTCRWTPGAHGETFLHTNYS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9244
Alternative names: CRLF1; cytokine receptor-like factor 1; CISS; CISS1; CLF; CLF 1; cold induced sweating syndrome; cytokine-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1; NR6; CLF-1; zcytor5;
Additional info: CRLF1 (Cytokine receptor-like factor 1) is a cytokine receptor subunit. It forms a heteromeric complex with cardiotrophin-like cytokine (CLC) and the CRLF1/CLC complex is a ligand for the ciliary neurotrophic factor receptor (CNTFR). Mutations in CRLF1 are responsible for both Crisponi and cold-induced sweating syndromes.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave