Qiagen
Home  >  Products  >  Anti-CIB1 (full length) polyclonal antibody

Anti-CIB1 (full length) polyclonal antibody

Cat no: DPABH-09804


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09804
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 10519
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human CIB1 aa 1-191.Sequence: MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLR AQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSD TATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMK QLIDNILEESDIDRDGTINLSEFQHVISRSPDFAS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 10519
Alternative names: CIB1; calcium and integrin binding 1 (calmyrin); calcium and integrin-binding protein 1; CALMYRIN; CIB; KIP; SIP2 28; CIBP; calmyrin; kinase-interacting protein; DNA-PKcs-interacting protein; SNK-interacting protein 2-28; Snk interacting protein 2-28; calcium- and integrin-binding protein; calcium and integrin binding protein 1; DNA-dependent protein kinase interacting protein; calcium and integrin binding, protein kinase interacting protein; KIP1; SIP2-28;
Additional info: May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain. Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. May play a role in regulation of apoptosis. Interacts with and up-regulates PTK2 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave