Qiagen
Home  >  Products  >  Anti-CDR2 (full length) polyclonal antibody

Anti-CDR2 (full length) polyclonal antibody

Cat no: DPABH-09316


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09316
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 1039
Form: Liquid
Antigen: Full length protein corresponding to Human CDR2 aa 1-454.Sequence: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ QMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQK LVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCD QEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQ
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 1039
Alternative names: CDR2; cerebellar degeneration-related protein 2, 62kDa; cerebellar degeneration related protein (62kD); cerebellar degeneration-related protein 2; CDR62; Yo; Yo paraneoplastic antigen; major Yo paraneoplastic antigen; paraneoplastic cerebellar degeneration-associated antigen;
Additional info: CDR2 (cerebellar degeneration-related protein 2, 62kDa) is a protein-coding gene. Diseases associated with CDR2 include gait apraxia, and paraneoplastic cerebellar degeneration. GO annotations related to this gene include protein binding and molecular_function. An important paralog of this gene is CDR2L.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave