Qiagen
Home  >  Products  >  Anti-CD46 (full length) polyclonal antibody

Anti-CD46 (full length) polyclonal antibody

Cat no: DPABH-09461


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09461
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 4179
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human CD46 aa 1-348. Isoform DSequence: MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKP KPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCP YIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIW SGKPPICEKVLCT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4179
Alternative names: CD46; CD46 molecule, complement regulatory protein; antigen identified by monoclonal TRA 2 10; CD46 antigen, complement regulatory protein; MCP, membrane cofactor protein (CD46, trophoblast lymphocyte cross reactive antigen); MIC10; membrane cofactor protein; MGC26544; TLX; TRA2.10; measles virus receptor; complement membrane cofactor protein; trophoblast leucocyte common antigen; trophoblast leukocyte common antigen; CD46 antigen, complement regulatory protein; trophoblast-lymphocyte cross-reactive antigen; antigen identified by monoclonal TRA-2-10; membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen); MCP; AHUS2; MIC10;
Additional info: Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens seem to exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave