Qiagen
Home  >  Products  >  Anti-CALCB (full length) polyclonal antibody

Anti-CALCB (full length) polyclonal antibody

Cat no: DPABH-09325


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09325
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 797
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human CALCB aa 1-127.Sequence: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLL AALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRS GGMVKSNFVPTNVGSKAFGRRRRDLQA Database link: P10092 Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 797
Alternative names: CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Additional info: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave