Qiagen
Home  >  Products  >  Anti-BSND (full length) polyclonal antibody

Anti-BSND (full length) polyclonal antibody

Cat no: DPABH-09621


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09621
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 7809
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human BSND aa 1-320.Sequence: MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGII WSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVR LWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGG PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7809
Alternative names: BSND; Bartter syndrome, infantile, with sensorineural deafness (Barttin); deafness, autosomal recessive 73; DFNB73; barttin; BART; deafness, autosomal recessive 73; DFNB73; MGC119283; MGC119284; MGC119285;
Additional info: BSND (Bartter syndrome, infantile, with sensorineural deafness (Barttin)) is a protein-coding gene. Diseases associated with BSND include hypokalemia, and bartter syndrome type 4a, and among its related super-pathways are Stimuli-sensing channels and SLC-mediated transmembrane transport. GO annotations related to this gene include chloride channel activity and chloride channel regulator activity.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave