Qiagen
Home  >  Products  >  Anti-BCS1L (full length) polyclonal antibody

Anti-BCS1L (full length) polyclonal antibody

Cat no: DPABH-09334


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09334
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 617
Form: Liquid
Antigen: Full length protein corresponding to Human BCS1L aa 1-419. NCBI: NP_004319.1Sequence: MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMIT LEVPARDRSYAWLLSWLTRHSTRTQHLSVETSYLQHESGRISTKFEFVPS PGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTALGTDRKVFFNI LEEARELALQQEEGKT
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 617
Alternative names: BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like; BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719; h-BCS1; BCS1-like protein; mitochondrial complex III assembly; PTD; BCS1; FLNMS; h-BCS; GRACILE;
Additional info: BCS1L (BCS1-like) is a chaperone necessary for the assembly of mitochondrial respiratory chain complex III. The protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave