Qiagen
Home  >  Products  >  Anti-BAG2 (full length) polyclonal antibody

Anti-BAG2 (full length) polyclonal antibody

Cat no: DPABH-09772


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09772
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9532
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human BAG2 aa 1-211. (NP_004273.1).Sequence: MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVE QEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVET IRNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEVPHGP VDQKFQSIVIGCALEDQKKI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9532
Alternative names: BAG2; BCL2-associated athanogene 2; BAG family molecular chaperone regulator 2; bcl-2-associated athanogene 2; BAG-family molecular chaperone regulator-2; dJ417I1.2 (BAG-family molecular chaperone regulator 2); BAG-2; dJ417I1.2; KIAA0576; MGC149462;
Additional info: Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave