Qiagen
Home  >  Products  >  Anti-ATP6V1B2 (full length) polyclonal antibody

Anti-ATP6V1B2 (full length) polyclonal antibody

Cat no: DPABH-09333


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09333
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 526
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human ATP6V1B2 aa 1-511.Sequence: MALRAMRGIVNGAAPELPVPTGGPAVGAQEQALAVSRNYLSQPRLTYKTV SGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE GTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDF LDIMGQPINPQCRIYPEEMIRTGISAIDGMN
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 526
Alternative names: ATP6V1B2; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2; ATP6B2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, 56/58kD, isoform 2; ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2; VPP3; V-type proton ATPase subunit B, brain isoform; HO57; VATB; Vma2; V-ATPase B2 subunit; V-ATPase subunit B 2; vacuolar proton pump subunit B 2; H+ transporting two-sector ATPase; vacuolar H+-ATPase 56,000 subunit; endomembrane proton pump 58 kDa subunit; VPP3; ATP6B2; ATP6B1B2;
Additional info: Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave