Qiagen
Home  >  Products  >  Anti-ABLIM1 (full length) polyclonal antibody

Anti-ABLIM1 (full length) polyclonal antibody

Cat no: DPABH-09484


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09484
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3983
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human ABLIM1 aa 1-401.Sequence: MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKV KAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDV RDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPI YKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3983
Alternative names: ABLIM1; actin binding LIM protein 1; ABLIM; LIMAB1; actin-binding LIM protein 1; abLIM; limatin; actin-binding double-zinc-finger protein; actin-binding LIM protein family member 1; ABLIM; LIMAB1; LIMATIN; abLIM-1; MGC1224; FLJ14564; KIAA0059; DKFZp781D0148;
Additional info: May act as scaffold protein (By similarity). May play a role in the development of the retina. Has been suggested to play a role in axon guidance.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave